worlds longest domain :\

[gh0st]

http://www.llanfairpwllgwyngyllgogerychwyrndrobwyll-llantysiliogogogoch.com/

breathtaking ;\

 

[Farrowlesparrow]

I've been through there(The place not the site)...The name is basically all there is

 

[UnkY]

if you even can pronounce it :x sooo large word (if you can even call it a word its more lettercombination )

 

[Foxtrot]

wtf...
Wow...

 

[Farrowlesparrow]

Its welsh, and you can pronounce it. Its part of their..."language"

(I like wales :O)

 

[UnkY]

You can pronounce it? WTF!

Well i can't pronounce it ^^ tried multiple times. didnt came further then llanfair

 

[gh0st]

i think the first part is pronounced "lan fair pool"

 

[Letters]

Good way to spam someone...

 

[Shippi]

So the name means 'St Mary's church in the hollow of the white hazel near a rapid whirlpool and the Church of St Tysilio of the red cave'

Woah. Crazy welsh

 

[Farrowlesparrow]

That reminds me...On a related note, my town (Stalybridge, and yes I own the rights to the town) has the longest pub name in Britain, as well as the shortest. The shortest is just Q and the longest is too long for me to remember. It also has, I believe, one of, if not the last station bar in England. By that, I mean a pub actually on the platform with the rest of the ticket office etc.

 

[oldagerocker]

kool stuff, you gotta love the welsh
I think the longest word ever is some chemical in german though, although i cant remember it

 

[Farrowlesparrow]

Well, its debatable what counts as a word. There are chemical names that are a thousand characters long, but they don't necessarily count as words.

 

[gh0st]

this is the chemical someone said

methionylglutaminylarginyltyrosylglutamylserylleucyl phenylalanylalanylglutaminylleucyllysylglutamylarginyl lysylglutamylglycylalanylphenylalanylvalylprolylphenyl alanylvalylthreonylleucylglycylaspartylprolylglycylisol eucylglutamylglutaminylserylleucyllysylisoleucylaspartyl threonylleucylisoleucylglutamylalanylglycylalanylaspartyl alanylleucylglutamylleucylglycylisoleucylprolylphenyl alanylserylaspartylprolylleucylalanylaspartylglycylprolyl threonylisoleucylglutaminylasparaginylalanylthreonylleucyl arginylalanylphenylalanylalanylalanylglycylvalylthreonyl prolylalanylglutaminylcysteinylphenylalanylglutamyl methionylleucylalanylleucylisoleucylarginylglutaminyllysyl histidylprolylthreonylisoleucylprolylisoleucylglycylleucyl leucylmethionyltyrosylalanylasparaginylleucylvalylphenyl alanylasparaginyllysylglycylisoleucylaspartylglutamylphenyl alanyltyrosylalanylglutaminylcysteinylglutamyllysylvalyl glycylvalylaspartylserylvalylleucylvalylalanylaspartylvalyl prolylvalylglutaminylglutamylserylalanylprolylphenylalanyl arginylglutaminylalanylalanylleucylarginylhistidylasparaginyl valylalanylprolylisoleucylphenylalanylisoleucylcysteinyl prolylprolylaspartylalanylaspartylaspartylaspartylleucyl leucylarginylglutaminylisoleucylalanylseryltyrosylglycyl arginylglycyltyrosylthreonyltyrosylleucylleucylserylarginyl alanylglycylvalylthreonylglycylalanylglutamylasparaginyl arginylalanylalanylleucylprolylleucylasparaginylhistidyl leucylvalylalanyllysylleucyllysylglutamyltyrosylasparaginyl alanylalanylprolylprolylleucylglutaminylglycylphenylalanyl glycylisoleucylserylalanylprolylaspartylglutaminylvalyllysyl alanylalanylisoleucylaspartylalanylglycylalanylalanylglycyl alanylisoleucylserylglycylserylalanylisoleucylvalyllysylisol eucylisoleucylglutamylglutaminylhistidylasparaginylisoleucyl glutamylprolylglutamyllysylmethionylleucylalanylalanylleucyl lysylvalylphenylalanylvalylglutaminylprolylmethionyllysyl alanylalanylthreonylarginylserine.

 

[nw909]

http://www.thelongestdomainnameintheworldandthensomeandthensomemoreandmore.com/default.htm

 

[Immortal]

I can get mt dad to say how its pronounced tomorrow, he's welsh. :thumbs:

 

[CyberSh33p]

I love welsh!

 

[[Matt]]

longest place name actually belongs to a town in thailand

Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit

 

[oldagerocker]

I thought the longest word was smiled...

/me flee's

 

[CyberSh33p]

longest place name actually belongs to a town in thailand

Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit

who the **** would name a place where they live and thus refer to on probably a daily basis name their town that?!